IFTAP Rabbit Polyclonal Antibody TA340304 from OriGene Technologies | Biocompare.com

Supplier Images

IFTAP Rabbit Polyclonal Antibody

WB Suggested Anti-C11orf74 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

Be the first to write a review!

Supplier Page from
OriGene Technologies for
IFTAP Rabbit Polyclonal Antibody

The IFTAP Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to IFTAP, and intraflagellar transport associated protein. This antibody recognizes Homo Sapiens, and Human antigen. The IFTAP Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-C11orf74 Antibody

Product Specs
ItemIFTAP Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340304
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetIFTAP
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C11orf74 antibody: synthetic peptide directed towards the middle region of human C11orf74. Synthetic peptide located within the following region: VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD
NCBI Full Gene Nameintraflagellar transport associated protein
NCBI Gene AliasesHEPIS, C11orf74, NWC
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!