Hsp20 (HSPB6) Rabbit Polyclonal Antibody TA346656 from OriGene Technologies | Biocompare.com

Supplier Images

Hsp20 (HSPB6) Rabbit Polyclonal Antibody

WB Suggested Anti-HSPB6 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Hsp20 (HSPB6) Rabbit Polyclonal Antibody

The Hsp20 (HSPB6) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to HSPB6. This antibody recognizes Homo Sapiens, and Human antigen. The Hsp20 (HSPB6) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-HSPB6 Antibody

Product Specs
ItemHsp20 (HSPB6) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA346656
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetHsp20
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-HSPB6 antibody: synthetic peptide directed towards the middle region of human HSPB6. Synthetic peptide located within the following region: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS
NCBI Full Gene Nameheat shock protein family B (small) member 6
NCBI Gene AliasesPPP1R91, HEL55, Hsp20
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!