IQSEC2 Rabbit Antibody TA332194 from OriGene Technologies | Biocompare.com

Supplier Images

IQSEC2 Rabbit Antibody

Host: Rabbit
Target Name: IQSEC2
Sample Type: MDA-MB-435S Whole Cell lysates
Antibody Dilution: 1.0ug/mlIQSEC2 is supported by BioGPS gene expression data to be expressed in MDA-MB435
IQSEC2 Rabbit Antibody

Host: Rabbit
Target: IQSEC2
Positive control (+): HeLa Cell Lysate (HL)
Negative control (-): HepG2 Cell Lysate (HG)
Antibody concentration: 1ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
IQSEC2 Rabbit Antibody

Description

Rabbit Polyclonal Anti-IQSEC2 Antibody

Product Specs
ItemIQSEC2 Rabbit Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA332194
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman
TargetIQSEC2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-IQSEC2 Antibody is: synthetic peptide directed towards the middle region of Human IQSEC2. Synthetic peptide located within the following region: ARTIQTAFRQYRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKA
NCBI Full Gene NameIQ motif and Sec7 domain ArfGEF 2
NCBI Gene AliasesMRX1, BRAG1, IQ-ArfGEF, MRX18, XLID1, MRX78
TypePrimary Antibodies
FormatShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!