FCRL4 Rabbit Polyclonal Antibody TA339576 from OriGene Technologies | Biocompare.com

Supplier Images

FCRL4 Rabbit Polyclonal Antibody

WB Suggested Anti-FCRL4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 2500; Positive Control: 293T cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FCRL4 Rabbit Polyclonal Antibody

The FCRL4 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to Fc receptor like 4, and FCRL4. This antibody recognizes Homo Sapiens, and Human antigen. The FCRL4 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-FCRL4 Antibody

Product Specs
ItemFCRL4 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339576
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetFCRL4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-FCRL4 antibody: synthetic peptide directed towards the N terminal of human FCRL4. Synthetic peptide located within the following region: FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR
NCBI Full Gene NameFc receptor like 4
NCBI Gene AliasesFCRH4, IRTA1, CD307d, IGFP2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!