Lgals4 Rabbit Polyclonal Antibody TA346427 from OriGene Technologies | Biocompare.com

Supplier Images

Lgals4 Rabbit Polyclonal Antibody

WB Suggested Anti-Lgals4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Mouse Brain

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Lgals4 Rabbit Polyclonal Antibody

The Lgals4 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Mouse antigen. The Lgals4 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Lgals4 Antibody

Product Specs
ItemLgals4 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346427
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetLgals4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Lgals4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLS
NCBI Full Gene Namelectin, galactose binding, soluble 4
NCBI Gene Aliasesgal-4
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!