DNAJC7 Rabbit Polyclonal Antibody TA338234 from OriGene Technologies | Biocompare.com

Supplier Images

DNAJC7 Rabbit Polyclonal Antibody

WB Suggested Anti-DNAJC7 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Be the first to write a review!

Supplier Page from
OriGene Technologies for
DNAJC7 Rabbit Polyclonal Antibody

OriGene Technologies' DNAJC7 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The DNAJC7 Rabbit Polyclonal Antibody was generated using DNAJC7 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-DNAJC7 Antibody

Product Specs
ItemDNAJC7 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338234
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
ReactivityHuman
TargetDNAJC7
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
TypePrimary Antibodies
ImmunogenThe immunogen for anti-DNAJC7 antibody is: synthetic peptide directed towards the C-terminal region of Human DNAJC7. Synthetic peptide located within the following region: KTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMH
NCBI Full Gene NameDnaJ heat shock protein family (Hsp40) member C7
NCBI Gene AliasesDJC7, DJ11, TPR2, TTC2
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!