RQCD1 (CNOT9) Rabbit Polyclonal Antibody TA331222 from OriGene Technologies | Biocompare.com

Supplier Images

RQCD1 (CNOT9) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RQCD1; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml; RQCD1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Be the first to write a review!

Citations:

Supplier Page from
OriGene Technologies for
RQCD1 (CNOT9) Rabbit Polyclonal Antibody

The RQCD1 (CNOT9) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The RQCD1 (CNOT9) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RQCD1 Antibody

Product Specs
ItemRQCD1 (CNOT9) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA331222
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRQCD1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK
NCBI Full Gene NameCCR4-NOT transcription complex subunit 9
NCBI Gene AliasesRCD-1, CT129, RCD1, RQCD1, CAF40
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!