Anti-SDF1 alpha antibody GTX45117 from GeneTex

Description

GeneTex's Anti-SDF1 alpha antibody is a Rabbit Polyclonal antibody. The Anti-SDF1 alpha antibody was generated using chemokine (C-X-C motif) ligand 12, Pbsf, Scyb12, Sdf1, Tlsf, Tpar1 as the antigen. The Anti-SDF1 alpha antibody from GeneTex is a Rabbit Polyclonal antibody to SDF1 alpha. The Anti-SDF1 alpha antibody Recognizes Mouse, Rat. The Anti-SDF1 alpha antibody has been validated for the following Applications: WB, IHC-P, IP, IHC

Product Specs
ItemAnti-SDF1 alpha antibody
CompanyGeneTex
Price $419.00Supplier Page
Catalog NumberGTX45117
Antibody TypePrimary Antibodies
FormatPBS, 0.1% Sodium azide
TargetSDF1 alpha
Conjugate/TagUnconjugated
ApplicationsWB, IHC-P, IP, IHC
HostRabbit
ReactivityMouse, Rat
ClonalityPolyclonal
Quantity100 µg
IsotypeIgG
PurityProtein A affinity purified
ImmunogenRecombinant protein was generated using E. coli-expressed mouse SDF-1α as an immunogen.The sequence of mouse SDF-1 alpha antigen is DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Concentration1mg/ml
NCBI Full Gene Namechemokine (C-X-C motif) ligand 12
NCBI Gene AliasesTpar1, Sdf1, Tlsf, Pbsf, chemokine (C-X-C motif) ligand 12, Pbsf, Scyb12, Sdf1, Tlsf, Tpar1, Scyb12
Research AreaImmunology
Gene NameCxcl12
Molecular Weight11
Modificationscleaved form

Add to Compare List

GeneTex

GeneTex, Inc. 2456 Alton Parkway

Irvine, California 92606

United States

Phone: 1-877-GeneTex (436-3839) or 949-553-1900
Fax: 949-309-2888

Company Profile

Website: http://www.genetex.com

(1) GDF11 promotes wound healing in diabetic mice via stimulating HIF-1ɑ-VEGF/SDF-1ɑ-mediated endothelial progenitor cell mobilization and neovascularizationActa pharmacologica SinicaMay 1, 2023Zhang Y, Zhang YY, Pan ZW, Li QQ, Sun LH, Li X, Gong MY, Yang XW, Wang YY, Li HD, et al.

(2) Effects of Astragaloside IV on the SDF-1/CXCR4 Expression in Atherosclerosis of apoE(-/-) Mice Induced by HyperlipaemiaEvidence-based complementary and alternative medicine : eCAMJanuary 1, 2015Qin H, Liu P, Lin S.Immunohistochemical Stain Immunohistochemical staining was performed as described [13] with the following antibodies: anti-SDF-1 (GeneTex, GTX45117) and anti-CXCR4 (GeneTex, GTX53457). Antigen granular or diffuse coloring, tan or brown pigmented cells

Be the First to Write a Review!

Anti-SDF1 alpha antibody

Anti-SDF1 alpha antibody

Anti-SDF1 alpha antibody from GeneTex

Description

GeneTex

Citations (2)

Reviews

Anti-SDF1 alpha antibody from GeneTex

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map