TfR (Transferrin R) Antibody

Product Specs
ItemTfR (Transferrin R) Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $579.00Supplier Page View Company Product Page
Catalog NumberNBP1-85741
ReactivityHuman
TargetTfR (Transferrin R)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
HostRabbit
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: KTECERLAGT ESPVREEPGE DFPAARRLYW DDLKRKLSEK LDSTDFTGTI KLLNENSYVP REAGSQKDEN LALYVENQFR EFKLSKV
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaCell Biology, Cellular Markers, Hematopoietic Stem Cell Markers, Immunology, Signal Transduction, Stem Cell Markers
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nametransferrin receptor
NCBI Gene AliasesCD71, IMD46, T9, TFR, TFR1, TR, TRFR, p90

KTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKV

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

(1) Mapping molecules in scanning far-field fluorescence nanoscopyNature communicationsJanuary 1, 0001"Ta H, Keller J, Haltmeier M, Saka SK, Schmied J, Opazo F, Tinnefeld P, Munk A, Hell SW."

(2) Hemochromatosis enhances tumor progression via upregulation of intracellular iron in head and neck cancerPloS oneJanuary 1, 0001"Lenarduzzi M, Hui AB, Yue S, Ito E, Shi W, Williams J, Bruce J, Sakemura-Nakatsugawa N, Xu W, Schimmer A, et al."

(3) E3 ubiquitin ligase rififylin has yin and yang effects on rabbit cardiac transient outward potassium currents (I(to)) and corresponding channel proteinsThe Journal of biological chemistryJanuary 1, 0001"Kabakov AY, Roder K, Bronk P, Turan NN, Dhakal S, Zhong M, Lu Y, Zeltzer ZA, Najman-Licht YB, Karma A, et al."Davis/NIH NeuroMab Facility; AB_2877317; 1:1000); rabbit anti transferrin receptor (Novus Biologicals; NBP1-85741; 1:1000); mouse anti Oct-A (Flag; Santa Cruz Biotechnology; sc-166355; 1:300); mouse anti c-Myc (Santa Cruz Biotechnology

TfR (Transferrin R) Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand