Pab Rb x rat GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody 370978 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x rat GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody

Western blot analysis of GPI expression in mouse thymus extract (lane 1). GPI at 64KD was detected using GPI at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x rat GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody

The Pab Rb x rat GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody from United States Biological is a Rabbit Polyclonal antibody to glucose-6-phosphate isomerase 1, and Gpi1. This antibody recognizes Mouse, and Rat antigen. The Pab Rb x rat GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x rat GPI, NT (Glucose-6-phosphate Isomerase, PGI, PHI) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number370978
Antibody TypePrimary
ReactivityMo, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to a sequence at the N-terminal of mouse GPI (aa2-39, AALTRNPQFQKLLEWHRANSANLKLRELFEADPERFNN), different from the related human sequence by 16aa, and from the related rat sequence by 2aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameglucose-6-phosphate isomerase 1
NCBI Gene AliasesPhi, MF, NK/GPI, Gpi, Gpi-1, Amf, Gpi-1r, Gpi-1s, NK, Gpi-1t, Org, Gpi1-r, Gpi1-s, Nlk, Pgi, Gpi1-t, Gpi1s
ClonalityPolyclonal
TargetGPI, NT

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!