Pab Rb x human TGFBR2 (TGF-beta Receptor Type-2, AAT3, HNPCC6, LDS2, MFS2, TAAD 2, TAAD2, TbetaR II, TbetaR-II, TGF beta Receptor II, TGF beta Receptor Type2, TGFR2, TGFR-2) antibody 353309 from United States Biological | Biocompare.com

Supplier Images

Pab Rb x human TGFBR2 (TGF-beta Receptor Type-2, AAT3, HNPCC6, LDS2, MFS2, TAAD 2, TAAD2, TbetaR II, TbetaR-II, TGF beta Receptor II, TGF beta Receptor Type2, TGFR2, TGFR-2) antibody

Western blotting All lanes: TGFBR2 at 0.5ug/ml Lane 1: MCF-7 Whole Cell Lysate at 40ug Lane 2: SW620 Whole Cell Lysate at 40ug Lane 3: 22RV1 Whole Cell Lysate at 40ug Lane 4: HELA Whole Cell Lysate at 40ug Predicted bind size: 85KD Observed bind size: 85KD

Be the first to write a review!

Supplier Page from
United States Biological for
Pab Rb x human TGFBR2 (TGF-beta Receptor Type-2, AAT3, HNPCC6, LDS2, MFS2, TAAD 2, TAAD2, TbetaR II, TbetaR-II, TGF beta Receptor II, TGF beta Receptor Type2, TGFR2, TGFR-2) antibody

The Pab Rb x human TGFBR2 (TGF-beta Receptor Type-2, AAT3, HNPCC6, LDS2, MFS2, TAAD 2, TAAD2, TbetaR II, TbetaR-II, TGF beta Receptor II, TGF beta Receptor Type2, TGFR2, TGFR-2) antibody from United States Biological is a Rabbit Polyclonal antibody to TGFBR2. This antibody recognizes Homo Sapiens, and Human antigen. The Pab Rb x human TGFBR2 (TGF-beta Receptor Type-2, AAT3, HNPCC6, LDS2, MFS2, TAAD 2, TAAD2, TbetaR II, TbetaR-II, TGF beta Receptor II, TGF beta Receptor Type2, TGFR2, TGFR-2) antibody has been shown to work in the following applications: Western Blot.

Product Specs
ItemPab Rb x human TGFBR2 (TGF-beta Receptor Type-2, AAT3, HNPCC6, LDS2, MFS2, TAAD 2, TAAD2, TbetaR II, TbetaR-II, TGF beta Receptor II, TGF beta Receptor Type2, TGFR2, TGFR-2) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number353309
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa96-128, TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK, of human TGFBR2 at N-terminal, different from the related mouse sequence by 5aa and from the related rat sequence by 8aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nametransforming growth factor beta receptor 2
NCBI Gene AliasesAAT3, FAA3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TBR-ii, TBRII, TGFR-2, TGFbeta-RII, tbetaR-II
ClonalityPolyclonal
TargetTGFBR2

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!