Rabbit Anti-SOX5, CT Antibody 303632 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-SOX5, CT Antibody

Anti-SOX5 antibody, Western blotting All lanes: Anti SOX5 at 0.5ug/ml Lane 1: Rat Liver Tissue Lysate at 50ug Lane 2: Rat Testis Tissue Lysate at 50ug Lane 3: Rat Brain Tissue Lysate at 50ug Lane 4: HELA Whole Cell Lysate at 40ug Lane 5: A549 Whole Cell Lysate at 40ug Predicted band size: 84KD Observed band size: 84KD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-SOX5, CT Antibody

United States Biological's Rabbit Anti-SOX5, CT Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rabbit Anti-SOX5, CT Antibody was generated using SOX5, and SRY-box transcription factor 5 as the antigen and it reacts with Homo Sapiens, Human, and Rat.

Product Specs
ItemRabbit Anti-SOX5, CT Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303632
Antibody TypePrimary
ReactivityHu, Rt
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa495-528, EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS, from human SOX5 at C-terminus, different from the related mouse sequence by 2aa
TargetSOX5, CT
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene NameSRY-box transcription factor 5
NCBI Gene AliasesL-SOX5, L-SOX5B, L-SOX5F, LAMSHF
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!