Rabbit Anti-SPARC, CT Antibody 303641 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-SPARC, CT Antibody

Anti-SPARC antibody, Western blotting All lanes: Anti SPARC at 0.5ug/ml Lane 1: HELA Whole Cell Lysate at 40ug Lane 2: 293T Whole Cell Lysate at 40ug Lane 3: MCF-7 Whole Cell Lysate at 40ug Predicted band size: 35KD Observed band size: 35KD

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-SPARC, CT Antibody

United States Biological's Rabbit Anti-SPARC, CT Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rabbit Anti-SPARC, CT Antibody was generated using SPARC as the antigen and it reacts with Homo Sapiens, and Human.

Product Specs
ItemRabbit Anti-SPARC, CT Antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number303641
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa268-303, RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI, from human SPARC at C-terminus, different from the related mouse and rat sequences by 4aa
TargetSPARC, CT
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namesecreted protein acidic and cysteine rich
NCBI Gene AliasesBM-40, OI17, ON, ONT
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!