TAT Antibody PA5-80097 from Thermo Fisher Scientific | Biocompare.com

Supplier Images
Published Figures

TAT Antibody

Western blot analysis of TAT in rat spleen extract (lane 1), mouse liver extract (lane 2) and A549 whole cell lysate (lane 3). Sample was incubated with TAT polyclonal antibody (Product # PA5-80097) at a dilution of 0.5 µg/mL. Signal development was performed using a chemiluminescence (ECL) kit.
TAT Antibody

TAT Antibody

Be the first to write a review!

Citations:

Figures:

Supplier Page from
Thermo Fisher Scientific for
TAT Antibody

Thermo Fisher Scientific's TAT Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The TAT Antibody was generated using Tat as the antigen and it reacts with Homo Sapiens, Human, Mouse, and Rat.

Product Specs
ItemTAT Antibody
CompanyThermo Fisher Scientific
Price Supplier Page
Catalog NumberPA5-80097
Quantity100 µg
ApplicationsWestern Blot
Concentration500 µg/mL
Conjugate/TagUnconjugated
FormatPBS with 5mg BSA and 0.05mg sodium azide
PurityAntigen affinity chromatography
ReactivityHuman, Mouse, Rat
TargetTAT
IsotypeIgG
HostRabbit
Antibody TypePrimary
Storage Temperature-20°C
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human ATTY (169-208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK)
NCBI Full Gene Nametyrosine aminotransferase
ClonalityPolyclonal
Storage-20°C

Add to Compare List

Thermo Fisher Scientific

Thermo Fisher Scientific

Thermo Fisher Scientific

81 Wyman Street

Waltham, MA 02451

United States

Phone: 800-678-5599
Fax: 800-331-2286

Company Profile

Website: www.thermofisher.com

Be the First to Write a Review!