Anti-LEXM Antibody Products

Anti-LEXM Antibody Products

Your search returned 68 LEXM Antibodies across 17 suppliers.
Showing 17 of 17 suppliers (68 products total)
  • <<
  • >>
Select up to 5 products from below to compare or request more information.
Biorbyt
LEXM antibody
  • Applications:
    WB, ELISA, IHC-p
  • Reactivity:
    Hu, Rt
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    20 ug (Trial Size), 50 ug, 100 ug
Reviews:
Citations:
LEXM antibody (Biotin)
  • Applications:
    ELISA
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Biotin
  • Quantity:
    50 ug, 100 ug
Reviews:
Citations:
MyBioSource.com
LEXM Antibody
  • Applications:
    WB, ELISA, IHC
  • Reactivity:
    Hu, Rt
  • Conjugate/Tag:
    Non-conjugated
  • Quantity:
    0.05 mg
Reviews:
Citations:
LEXM Antibody, FITC conjugated
  • Applications:
    ELISA
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    FITC conjugated
  • Quantity:
    0.05 mg
Reviews:
Citations:
Atlas Antibodies
Anti-LEXM Antibody
  • Applications:
    WB, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    unconjugated
  • Quantity:
    100 µl
Reviews:
Citations:
Anti-LEXM Antibody
  • Applications:
    WB, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    unconjugated
  • Quantity:
    100 µl
Reviews:
Citations:
Biomatik
LEXM Polyclonal Antibody
  • Applications:
    WB, ELISA, IHC
  • Reactivity:
    Hu, Rt
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100ug
Reviews:
Citations:
LifeSpan BioSciences
C1orf177 Polyclonal Antibody
  • Applications:
    WB, ELISA, IHC
  • Reactivity:
    Hu, Rt
  • Conjugate/Tag:
    Unconjugated, Biotin, HRP, FITC
  • Quantity:
    50 µg
Reviews:
Citations:
C1orf177 Polyclonal Antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Hu, Bv, Dg, Hr
  • Conjugate/Tag:
    Unconjugated, Biotin, FITC, HRP
  • Quantity:
    50 µg
Reviews:
Citations:
antibodies-online
anti-Chromosome 1 Open Reading Frame 177 (C1ORF177) (Middle Region) antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    50 µg
Reviews:
Citations:
Thermo Fisher Scientific
C1orf177 Polyclonal Antibody
  • Applications:
    WB, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 µL
Reviews:
Citations:
C1orf177 Polyclonal Antibody
  • Applications:
    WB, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 µL
Reviews:
Citations:
Novus Biologicals
Lymphocyte Expansion Molecule Antibody
  • Applications:
    WB, IHC, IHC-p
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    0.1 ml
Reviews:
Citations:
Lymphocyte Expansion Molecule Antibody
  • Applications:
    WB, IHC, IHC-p
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    0.1 ml
Reviews:
Citations:
ProSci, Inc
C1orf177 Antibody
  • Applications:
    WB, ELISA
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 ul
Reviews:
Citations:
GeneTex
Anti-C1ORF177 antibody, Internal
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    50 µg
Reviews:
Citations:
OriGene Technologies
Rabbit Polyclonal Anti-C1orf177 Antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Hu, Ms, Rb, Rt, Bv, Dg, Hr
  • Quantity:
    50ug
Reviews:
Citations:
FabGennix International, Inc.
C1ORF177 Antibody
  • Applications:
    WB, ELISA, IHC, IP
  • Reactivity:
    Hu, Ms, Rt
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 ug
Reviews:
Citations:
C1ORF177 Antibody BIOTIN
  • Applications:
    WB, ELISA, IHC, IP
  • Reactivity:
    Hu, Ms, Rt
  • Conjugate/Tag:
    BIOTIN
  • Quantity:
    100 ug
Reviews:
Citations:
Bioss Inc.
C1orf177 Antibody
  • Applications:
    WB, IF, IHC-p
  • Reactivity:
    Hu, Ms, Rt
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100ul
Reviews:
Citations:
C1orf177 Antibody
  • Applications:
    WB, IF, IHC-p
  • Reactivity:
    Hu, Ms, Rt
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100ul
Reviews:
Citations:
Fitzgerald Industries International
C1ORF177 antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    50 ug
Reviews:
Citations:
Abnova Corporation
C1orf177 polyclonal antibody
  • Applications:
    WB, IHC-p
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 uL
Reviews:
Citations:
United States Biological
Rabbit Anti-C1ORF177 Antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Hu, Ms, Rb, Rt, Bv, Ca, Hr
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100ul
Reviews:
Citations:
Creative Diagnostics
Anti-C1ORF177 (aa 252-301 9SMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPK TPTERIYWANL) polyclonal antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    1 mg
Reviews:
Citations:
Select up to 5 products from above to compare or request more information.

Tags:

Please Login or Register to Create Tags

Guided Browse

Browse Antibodies by Antigen

Browse Antibodies by Clone