Anti-LEXM Antibody Products

Anti-LEXM antibodies are offered by a number of suppliers. This target gene encodes the protein 'lymphocyte expansion molecule' in humans and may also be known as lem and C1orf177. Structurally, the protein is reported to be 47.6 kilodaltons in mass. Based on gene name, canine, porcine, monkey, mouse and rat orthologs may also be found. For more comprehensive antibody product information (such as immunogen, specificity, applications, and more), visit the supplier page.

Anti-LEXM Antibody Products

Your search returned 77 LEXM Antibodies across 17 suppliers.
Showing 17 of 17 suppliers (77 products total)
  • <<
  • >>
Select up to 5 products from below to compare or request more information.

Sponsored Products

MyBioSource.com
LEXM Antibody - middle region
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Hu, Ms, Rb, Rt, Bv, Dg, Hr
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    0.1 mL
Reviews:
Citations:
LEXM Antibody, HRP conjugated
  • Applications:
    ELISA
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    HRP conjugated
  • Quantity:
    0.05 mg
Reviews:
Citations:
Biorbyt
LEXM antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Hu, Ms, Rt, Bv, Ca
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 ul
Reviews:
Citations:
LEXM antibody
  • Applications:
    WB, ELISA, IHC-p
  • Reactivity:
    Hu, Rt
  • Conjugate/Tag:
    Unconjugated, Unconjugated, Biotin, FITC, HRP, CF647, CF488A...
  • Quantity:
    50 ug, 100 ug
Reviews:
Citations:
CUSABIO Technology LLC
LEXM Antibody
  • Applications:
    WB, ELISA, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Non-conjugated
  • Quantity:
    100µg
Reviews:
Citations:
Atlas Antibodies
Anti-LEXM Antibody
  • Applications:
    WB, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    unconjugated
  • Quantity:
    100 µl
Reviews:
Citations:
Anti-LEXM Antibody
  • Applications:
    WB, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    unconjugated
  • Quantity:
    100 µl
Reviews:
Citations:
OriGene Technologies
Rabbit Polyclonal Anti-C1orf177 Antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 µl
Reviews:
Citations:
LifeSpan BioSciences
C1orf177 Antibody
  • Applications:
    WB, ELISA, IHC
  • Reactivity:
    Hu, Rt
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    50 µg
Reviews:
Citations:
C1orf177 Antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Hu, Bv, Dg, Hr
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 µl
Reviews:
Citations:
Thermo Fisher Scientific
C1orf177 Polyclonal Antibody
  • Applications:
    WB, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 µL
Reviews:
Citations:
C1orf177 Polyclonal Antibody
  • Applications:
    WB, IHC
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 µL
Reviews:
Citations:
ProSci, Inc
C1orf177 Antibody
  • Applications:
    WB, ELISA
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 ul
Reviews:
Citations:
GeneTex
Anti-C1ORF177 antibody, Internal
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    50 µg
Reviews:
Citations:
Novus Biologicals
Lymphocyte Expansion Molecule Antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Hu, Ms, Rb, Rt, Bv, Ca, Hr
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 ul (also 20ul)
Reviews:
Citations:
Lymphocyte Expansion Molecule Antibody
  • Applications:
    WB, IHC, IHC-p
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    0.1 ml
Reviews:
Citations:
Bioss Inc.
C1orf177 Antibody
  • Applications:
    WB, IF, IHC-p
  • Reactivity:
    Hu, Ms, Rt
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100ul
Reviews:
Citations:
C1orf177 Antibody
  • Applications:
    WB, IF, IHC-p
  • Reactivity:
    Hu, Ms, Rt
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100ul
Reviews:
Citations:
FabGennix International, Inc.
C1ORF177 Antibody
  • Applications:
    WB, ELISA, IHC, IP
  • Reactivity:
    Mouse (Ms)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 ug
Reviews:
Citations:
C1ORF177 Antibody BIOTIN
  • Applications:
    WB, ELISA, IHC, IP
  • Reactivity:
    Mouse (Ms)
  • Conjugate/Tag:
    BIOTIN
  • Quantity:
    100 ug
Reviews:
Citations:
Fitzgerald Industries International
C1ORF177 antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    50 ug
Reviews:
Citations:
Abcam
Anti-C1orf177 antibody
  • Applications:
    WB, IHC-p
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 µl
Reviews:
Citations:
Anti-C1orf177 antibody
  • Applications:
    WB, IHC-p
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 µl
Reviews:
Citations:
Abnova Corporation
C1orf177 polyclonal antibody
  • Applications:
    WB, IHC-p
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100 uL
Reviews:
Citations:
United States Biological
Rabbit Anti-C1ORF177 Antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Hu, Ms, Rb, Rt, Bv, Ca, Hr
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    100ul
Reviews:
Citations:
Creative Diagnostics
Anti-C1ORF177 (aa 252-301 9SMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPK TPTERIYWANL) polyclonal antibody
  • Applications:
    Western Blot (WB)
  • Reactivity:
    Human (Hu)
  • Conjugate/Tag:
    Unconjugated
  • Quantity:
    1 mg
Reviews:
Citations:
Select up to 5 products from above to compare or request more information.

Tags:

Please Login or Register to Create Tags

Guided Browse

Browse Antibodies by Antigen

Browse Antibodies by Clone