Cytochrome b5 type A Antibody - BSA Free NBP2-49284 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Cytochrome b5 type A Antibody

Western Blot: Cytochrome b5 type A Antibody [NBP2-49284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Cytochrome b5 type A Antibody

Cytochrome b5 type A Antibody
Cytochrome b5 type A Antibody

Western Blot: Cytochrome b5 type A Antibody [NBP2-49284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Cytochrome b5 type A Antibody

Western Blot: Cytochrome b5 type A Antibody [NBP2-49284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Cytochrome b5 type A Antibody

Western Blot: Cytochrome b5 type A Antibody [NBP2-49284] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Cytochrome b5 type A Antibody - BSA Free

Product Specs
ItemCytochrome b5 type A Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-49284
Quantity0.1 ml
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
PurityAffinity purified
TargetCytochrome b5 type A
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: MAEQSDEAVK YYTLEEIQKH NHSKSTWLIL HHKVYDLTKF LAEHPGG
Antibody TypePrimary Antibodies
ClonalityPolyclonal
Research AreaCancer, Lipid and Metabolism, Stem Cell Markers
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namecytochrome b5 type A
NCBI Gene AliasesCYB5, MCB5, METAG

Specifications/Features

Available conjugates: Unconjugated

Sequence

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!