Rngtt Rabbit Polyclonal Antibody TA346717 from OriGene Technologies | Biocompare.com

Supplier Images

Rngtt Rabbit Polyclonal Antibody

WB Suggested Anti-Rngtt Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rngtt Rabbit Polyclonal Antibody

The Rngtt Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RNGTT. This antibody recognizes Mouse antigen. The Rngtt Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Rngtt Antibody

Product Specs
ItemRngtt Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346717
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetRngtt
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Rngtt antibody is: synthetic peptide directed towards the N-terminal region of Rngtt. Synthetic peptide located within the following region: DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE
NCBI Full Gene NameRNA guanylyltransferase and 5'-phosphatase
NCBI Gene AliasesMCE1, HCE
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!