Protein downstream neighbor of Son (DONSON) Rabbit Polyclonal Antibody TA338938 from OriGene Technologies | Biocompare.com

Supplier Images

Protein downstream neighbor of Son (DONSON) Rabbit Polyclonal Antibody

DONSON antibody - middle region validated by WB using Mouse brains at 1: 1000.
Protein downstream neighbor of Son (DONSON) Rabbit Polyclonal Antibody

WB Suggested Anti-DONSON Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate.DONSON is supported by BioGPS gene expression data to be expressed in HepG2

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Protein downstream neighbor of Son (DONSON) Rabbit Polyclonal Antibody

The Protein downstream neighbor of Son (DONSON) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to Donson. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The Protein downstream neighbor of Son (DONSON) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-DONSON Antibody

Product Specs
ItemProtein downstream neighbor of Son (DONSON) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338938
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Mouse
TargetProtein downstream neighbor of Son
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DONSON antibody: synthetic peptide directed towards the middle region of human DONSON. Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
NCBI Full Gene NameDNA replication fork stabilization factor DONSON
NCBI Gene AliasesB17, MIMIS, MISSLA, C21orf60
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!