uronyl 2 sulfotransferase (UST) Rabbit Polyclonal Antibody TA339021 from OriGene Technologies | Biocompare.com

Supplier Images

uronyl 2 sulfotransferase (UST) Rabbit Polyclonal Antibody

WB Suggested Anti-UST Antibody Titration: 0.2-1 ug/ml; Positive Control: PANC1 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
uronyl 2 sulfotransferase (UST) Rabbit Polyclonal Antibody

OriGene Technologies' uronyl 2 sulfotransferase (UST) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-UST Antibody

Product Specs
Itemuronyl 2 sulfotransferase (UST) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA339021
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
Targeturonyl 2 sulfotransferase
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-UST antibody: synthetic peptide directed towards the N terminal of human UST. Synthetic peptide located within the following region: PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL
NCBI Full Gene Nameuronyl 2-sulfotransferase
NCBI Gene Aliases2OST
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!