S100A3 Rabbit Polyclonal Antibody TA346335 from OriGene Technologies | Biocompare.com

Supplier Images

S100A3 Rabbit Polyclonal Antibody

WB Suggested Anti-S100A3 Antibody Titration: 5.0 ug/ml; Positive Control: OVCAR-3 cell lysate.S100A3 is supported by BioGPS gene expression data to be expressed in OVCAR3
S100A3 Rabbit Polyclonal Antibody

Rabbit Anti-S100A3 Antibody; Paraffin Embedded Tissue: Human Skin; Cellular Data: Squamous epithelial cells; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Be the first to write a review!

Supplier Page from
OriGene Technologies for
S100A3 Rabbit Polyclonal Antibody

The S100A3 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Homo Sapiens, and Human antigen. The S100A3 Rabbit Polyclonal Antibody has been shown to work in the following applications: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-S100A3 Antibody

Product Specs
ItemS100A3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA346335
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetS100A3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-S100A3 antibody: synthetic peptide directed towards the N terminal of human S100A3. Synthetic peptide located within the following region: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF
NCBI Full Gene NameS100 calcium binding protein A3
NCBI Gene AliasesS100E
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!