C15orf33 (FAM227B) Rabbit Polyclonal Antibody TA338894 from OriGene Technologies | Biocompare.com

Supplier Images

C15orf33 (FAM227B) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: FAM227B; Sample Tissue: Liver tumor lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C15orf33 (FAM227B) Rabbit Polyclonal Antibody

The C15orf33 (FAM227B) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to FAM227B. This antibody recognizes Homo Sapiens, and Human antigen. The C15orf33 (FAM227B) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-FAM227B Antibody

Product Specs
ItemC15orf33 (FAM227B) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338894
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetC15orf33
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-FAM227B antibody is: synthetic peptide directed towards the N-terminal region of Human FAM227B. Synthetic peptide located within the following region: EYSLILQNHTSEIFKWKSMISETSSYRKLERYGEFLKKYHKKKKIMLSDE
NCBI Full Gene Namefamily with sequence similarity 227 member B
NCBI Gene AliasesC15orf33
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!