CEACAM7 Rabbit Polyclonal Antibody TA342851 from OriGene Technologies | Biocompare.com

Supplier Images

CEACAM7 Rabbit Polyclonal Antibody

WB Suggested Anti-CEACAM7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
CEACAM7 Rabbit Polyclonal Antibody

The CEACAM7 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to CEA cell adhesion molecule 7, and CEACAM7. This antibody recognizes Homo Sapiens, and Human antigen. The CEACAM7 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-CEACAM7 Antibody

Product Specs
ItemCEACAM7 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA342851
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetCEACAM7
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-CEACAM7 antibody: synthetic peptide directed towards the C terminal of human CEACAM7. Synthetic peptide located within the following region: FSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPR
NCBI Full Gene NameCEA cell adhesion molecule 7
NCBI Gene AliasesCGM2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!