E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody TA331936 from OriGene Technologies | Biocompare.com

Supplier Images

E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody

WB Suggested Anti-PIAS4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody

The E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to PIAS4. This antibody recognizes Homo Sapiens, and Human antigen. The E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-PIAS4 Antibody

Product Specs
ItemE3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA331936
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetE3 SUMO protein ligase PIAS4
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-PIAS4 Antibody: synthetic peptide directed towards the N terminal of human PIAS4. Synthetic peptide located within the following region: AKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKK
NCBI Full Gene Nameprotein inhibitor of activated STAT 4
NCBI Gene AliasesPIASY, ZMIZ6, PIAS-gamma, Piasg
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!