Pit1 (POU1F1) Rabbit Polyclonal Antibody TA330245 from OriGene Technologies | Biocompare.com

Supplier Images

Pit1 (POU1F1) Rabbit Polyclonal Antibody

WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Liver

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Pit1 (POU1F1) Rabbit Polyclonal Antibody

OriGene Technologies' Pit1 (POU1F1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-POU1F1 Antibody

Product Specs
ItemPit1 (POU1F1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA330245
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetPit1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-POU1F1 antibody: synthetic peptide directed towards the middle region of human POU1F1. Synthetic peptide located within the following region: KRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNR
NCBI Full Gene NamePOU class 1 homeobox 1
NCBI Gene AliasesPIT1, POU1F1a, CPHD1, Pit-1, GHF-1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!