HABP1/C1QBP/GC1q R Antibody - BSA Free NBP1-89790 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

HABP1/C1QBP/GC1q R Antibody

Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HABP1/C1QBP/GC1q R Antibody

HABP1/C1QBP/GC1q R Antibody
HABP1/C1QBP/GC1q R Antibody

Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HABP1/C1QBP/GC1q R Antibody

Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
HABP1/C1QBP/GC1q R Antibody

Western Blot: HABP1/C1QBP/GC1q R Antibody [NBP1-89790] - Analysis in human cell lines HEK293 and U2OS using Anti-C1QBP antibody. Corresponding C1QBP RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
HABP1/C1QBP/GC1q R Antibody - BSA Free

Product Specs
ItemHABP1/C1QBP/GC1q R Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-89790
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)
HostRabbit
FormatPBS (pH 7.2) and 40% Glycerol
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: GGWELELNGT EAKLVRKVAG EKITVTFNIN NSIPPTFDGE EEPSQGQKVE EQEPELTSTP NFVVEVIKND DGKKALVLDC HY
ReactivityHuman,Mouse,Rat
ApplicationsIF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
TargetHABP1/C1QBP/GC1q R
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaStem Cell Markers
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namecomplement C1q binding protein
NCBI Gene AliasesCOXPD33, GC1QBP, HABP1, SF2AP32, SF2p32, gC1Q-R, gC1qR, p32

Sequence

GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!