TSPAN7/TM4SF2 Antibody

Product Specs
ItemTSPAN7/TM4SF2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $549.00Supplier Page View Company Product Page
Catalog NumberNBP1-90310
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: TFLRTYTDAM QTYNGNDERS RAVDHVQRSL SCCGVQNYTN WSTSPYFLEH GIPPSCCMNE TDCNPQDLHN LTVAATKVNQ KGCYDLVTSF MET
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
ReactivityHuman
ClonalityPolyclonal
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesA15, CCG-B7, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2, TM4SF2b, XLID58
NCBI Full Gene Nametetraspanin 7
Research Areametabolism
PurityAffinity purified
IsotypeIgG
TargetTSPAN7/TM4SF2
HostRabbit

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Sequence

TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Single-Cell Sequencing of iPSC-Dopamine Neurons Reconstructs Disease Progression and Identifies HDAC4 as a Regulator of Parkinson Cell PhenotypesCell stem cellJanuary 3, 2019Lang C, Campbell KR, Ryan BJ, Carling P, Attar M, Vowles J, Perestenko OV, Bowden R, Baig F, Kasten M, et al.3501), FKBP9 (1:500 Abcam ab91219), Ero1-Lα (1:500 Cell signaling 9956), TSPAN7 (1:250 Novus Biologicals NBP1-90310), Na+/K+-ATPase α3 (1:500 Santa cruz sc-365744), Rtn1/2 (1:500 Santa cruz sc-71981), PRKCB (1:250 ProSci

(2) "CD31, EDNRB and TSPAN7 are promising prognostic markers in clear-cell renal cell carcinoma revealed by genome-wide expression analyses of primary tumors and metastases"International journal of cancerJanuary 1, 0001"Wuttig D, Zastrow S, Füssel S, Toma MI, Meinhardt M, Kalman K, Junker K, Sanjmyatav J, Boll K, Hackermüller J, et al."

(3) The Human Protein Atlas--a tool for pathologyThe Journal of pathologyJanuary 1, 0001"Pontén F, Jirström K, Uhlen M."

(4) Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic isletsDiscovery medicineJanuary 1, 0001"Lindskog C, Asplund A, Engkvist M, Uhlen M, Korsgren O, Ponten F."

(5) Tetraspanin-7 regulation of L-type voltage-dependent calcium channels controls pancreatic β-cell insulin secretionThe Journal of physiologyJanuary 1, 0001"Dickerson MT, Dadi PK, Butterworth RB, Nakhe AY, Graff SM, Zaborska KE, Schaub CM, Jacobson DA."nitrocellulose membrane. Immunoblots were probed with rabbit anti-TSPAN-7 (dilution 1:200; catalogue no. NBP1-90310; Novus, Phoenix, AZ, USA) and TSPAN-7 protein bands visualized with anti-rabbit HRP-conjugated secondary

Be the First to Write a Review!