APOBEC2 Antibody - BSA Free NBP1-88848 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

APOBEC2 Antibody

Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Analysis in human skeletal muscle and liver tissues using NBP1-88848 antibody. Corresponding APOBEC2 RNA-seq data are presented for the same tissues.
APOBEC2 Antibody

APOBEC2 Antibody
APOBEC2 Antibody

Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Analysis in human skeletal muscle and liver tissues using NBP1-88848 antibody. Corresponding APOBEC2 RNA-seq data are presented for the same tissues.
APOBEC2 Antibody

Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Analysis in human skeletal muscle and liver tissues using NBP1-88848 antibody. Corresponding APOBEC2 RNA-seq data are presented for the same tissues.
APOBEC2 Antibody

Immunohistochemistry-Paraffin: APOBEC2 Antibody [NBP1-88848] - Analysis in human skeletal muscle and liver tissues using NBP1-88848 antibody. Corresponding APOBEC2 RNA-seq data are presented for the same tissues.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
APOBEC2 Antibody - BSA Free

Product Specs
ItemAPOBEC2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-88848
FormatPBS (pH 7.2) and 40% Glycerol
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: GRLFMWEEPE IQAALKKLKE AGCKLRIMKP QDFEYVWQNF VEQEEGESKA FQPWEDIQEN FLYYEEKLAD ILK
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
ReactivityHuman
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin
TargetAPOBEC2
HostRabbit
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameapolipoprotein B mRNA editing enzyme catalytic subunit 2
NCBI Gene AliasesARCD1, ARP1

Sequence

GRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!