Alix Antibody

Product Specs
ItemAlix Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $569.00Supplier Page View Company Product Page
Catalog NumberNBP1-90201
Quantity0.1 ml (also 25ul)
TargetAlix
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: VPVSVQQSLA AYNQRKADLV NRSIAQMREA TTLANGVLAS LNLPAAIEDV SGDTVPQSIL TKSRSVIEQG GIQTVDQLIK ELPELLQRNR EILDESLRLL DEEEATDND
ReactivityHuman
FormatPBS (pH 7.2) and 40% Glycerol
ApplicationsWB, ICC, IF, IHC, IHC-p
IsotypeIgG
ClonalityPolyclonal
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesAIP1, ALIX, DRIP4, HP95, MCPH29
NCBI Full Gene Nameprogrammed cell death 6 interacting protein
Research AreaApoptosis
PurityAffinity purified
HostRabbit
Conjugate/TagUnconjugated

Sequence

VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDND

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Glycolytic Enzyme HK2 Phosphorylates nSMase1 to Promote Astrocytic Exosomes Biogenesis Contributing to Acute Ischemic Stroke InjuryAdvanced science (Weinheim, Baden-Wurttemberg, Germany)October 1, 2025Chen C, Zhou Y, Sheng L, Mai F, Ding Y, Hong S, Wu J, Pi J, Yan G, Huang Y, et al.primary antibodies used including anti‐CD63 (abcam, ab217345), anti‐CD81 (CST, 10073), anti‐ALIX (Novus, NBP1‐90201), anti‐Calnexin (abcam, ab22595), anti‐α‐Tubulin (CST, 2125), anti‐Flotillin (CST, 18634), anti‐nSMase

(2) ATP Synthase Abundance in Neuronal Extracellular Vesicles Reflects Changes in the Mitochondria of Parent NeuronsJournal of extracellular vesiclesAugust 1, 2025Yao PJ, Nogueras-Ortiz C, Pucha KA, Kapogiannis D.anti‐L1CAM Ab (554273, BD Biosciences), rabbit anti‐L1CAM Ab (ab208155, abcam), rabbit anti‐Alix Ab (NBP1‐90201, Novus), mouse anti‐OXPHOS Ab cocktail (ab110413, abcam), rabbit anti‐ATP synthase_α Ab (176569, abcam),

(3) Extracellular Vesicle Marker Changes Associated With Disease Activity in Relapsing-Remitting Multiple SclerosisNeurology Neuroimmunology & NeuroinflammationJuly 1, 2025Victoria Lim Falk, Nicole Mueller-Wirth, Dimitris Karathanasis, Maria Eleftheria Evangelopoulos, Aleksandra Maleska Maceski, Amar Zadic, Jens Kuhle, Cornelia Schlup, Stefanie Marti, Kirsten Guse, et al.for 1 hour at RT. Thereafter, membranes were incubated with a primary antibody against Alix (1:500, NBP1-90201, Novus Biologicals, Centennial, CO) in a rolling shaker overnight at 4°C. Because tetraspanins were

(4) Presenilins as hub proteins controlling the endocytic and autophagic pathways and small extracellular vesicle secretionJ Extracell VesiclesJanuary 16, 2025Inger Lauritzen, Anaïs Bini, Anaïs Bécot, Anne-Sophie Gay, Céline Badot, Sophie Pagnotta, Mounia Chami, Frédéric Checler1:1000), α‐CD9 (anti‐mouse, eBioKMC8, 1:1000) anti‐CD81 (anti‐mouse, Ebioscience, 1:1000), α‐Alix (Novus, NBP1‐90201, 1:500), α‐Hsc70 (Santa Cruz, B‐6, sc‐7298, 1:1000), α‐Tsg101 (Santa Cruz, C‐2, sc‐7964, 1:1000), α‐Flotilin2

(5) A novel function and mechanism of ischemia-induced retinal astrocyte-derived exosomes for RGC apoptosis of ischemic retinopathyMolecular therapy. Nucleic acidsJune 11, 2024Ye X, Liu Y, Chen C, Sun Y, Li F, Fu Y, Luo J, Su L, Chi W.488 Conjugate,Invitrogen Alexa Fluor 549 Conjugate,Invitrogen Anti-Alix rabbit pAb,"Novus, Cat#. NBP1-90201" Anti-Bax rabbit Ab,"Cell signaling, Cat#. 2772s" Anti-Bcl-2 rabbit mAb,"Cell signaling, Cat#. 2870s" Anti-Calnexin

(6) Molecular determinants of the crosstalk between endosomal microautophagy and chaperone-mediated autophagyCell reportsDecember 26, 2023Krause GJ, Kirchner P, Stiller B, Morozova K, Diaz A, Chen KH, Krogan NJ, Agullo-Pascual E, Clement CC, Lindenau K, et al.

(7) Extracellular vesicle biomarkers for cognitive impairment in Parkinson's diseaseBrain : a journal of neurologyJanuary 5, 2023Blommer J, Pitcher T, Mustapic M, Eren E, Yao PJ, Vreones MP, Pucha KA, Dalrymple-Alford J, Shoorangiz R, Meissner WG, et al.

(8) Identification of RNA content of CHO-derived extracellular vesicles from a production processJournal of biotechnologyMarch 20, 2022Busch DJ, Zhang Y, Kumar A, Huhn SC, Du Z, Liu R.

(9) Extracellular Vesicles from 3D Engineered Microtissues Harbor Disease-Related Cargo Absent in EVs from 2D CulturesAdvanced healthcare materialsMarch 1, 2022Millan C, Prause L, Vallmajo-Martin Q, Hensky N, Eberli D.

(10) HIV-1 Nef Protein Affects Cytokine and Extracellular Vesicles Production in the GEN2.2 Plasmacytoid Dendritic Cell LineVirusesDecember 31, 2021Aiello A, Giannessi F, Percario ZA, Fecchi K, Arenaccio C, Leone S, Carollo M, D'Aversa E, Chaperot L, Gambari R, et al.Irvine, CA, USA, cat. #GTX70255), rabbit polyclonal anti-Alix (Novus Biologicals, Milan, Italy, cat. #NBP1-90201), rabbit polyclonal anti-Hsp90 (Santa Cruz Biotechnology, Dallas, TX, USA, cat. #sc-7947), mouse monoclonal

(11) Mitochondrial Electron Transport Chain Protein Abnormalities Detected in Plasma Extracellular Vesicles in Alzheimer's DiseaseBiomedicinesOctober 31, 2021Yao PJ, Eren E, Goetzl EJ, Kapogiannis D.were blocked with 5% non-fat milk in TBS-T for 1 hr at RT. Membranes were incubated with Alix (1:1000; NBP1-90201; Novus Biologicals, Centennial, CO, USA), CD9 (1:500; #312102; Biolegend, San Diego, CA, USA), GM130

(12) Decreased expression of the translation factor eIF3e induces senescence in breast cancer cells via suppression of PARP1 and activation of mTORC1OncotargetMarch 30, 2021Morris C, Durand S, Jalinot P.

(13) Raman Fingerprint of Extracellular Vesicles and Conditioned Media for the Reproducibility Assessment of Cell-Free TherapeuticsFrontiers in bioengineering and biotechnologyJanuary 1, 2021Carlomagno C, Giannasi C, Niada S, Bedoni M, Gualerzi A, Brini AT.Madison, WI, United States) in PBS, samples were probed overnight at 4°C for the expression of Alix (NBP1-90201, 1:1,000 diluted, Novus Biologicals, Centennial, CO, United States), FLOT-1 (1:500 diluted, BD Transduction

(14) Exploring brain insulin resistance in adults with bipolar depression using extracellular vesicles of neuronal originJournal of psychiatric researchJanuary 1, 2021Mansur RB, Delgado-Peraza F, Subramaniapillai M, Lee Y, Iacobucci M, Nasri F, Rodrigues N, Rosenblat JD, Brietzke E, Cosgrove VE, et al.(1:500; cat. no. EXOAB-CD81A-1, System Biosciences) and alix (0.4 μg/mL; RRID: AB_11023702, cat. no. NBP1–90201, Novus Biologicals, Littleton, CO), respectively. Enrichment of NEVs by L1CAM/CD171 immunoprecipitation

(15) Astrocyte- and Neuron-Derived Extracellular Vesicles from Alzheimer's Disease Patients Effect Complement-Mediated NeurotoxicityCellsJuly 4, 2020Nogueras-Ortiz CJ, Mahairaki V, Delgado-Peraza F, Das D, Avgerinos K, Eren E, Hentschel M, Goetzl EJ, Mattson MP, Kapogiannis D.(1:500; cat. no. EXOAB-CD81A-1, System Biosciences) and alix (0.4 µg/mL; RRID: AB_11023702, cat. no. NBP1-90201, Novus Biologicals, Littleton, CO, USA), respectively [45]. Antibody excess was washed five times with TBS

(16) Plasma membrane damage causes NLRP3 activation and pyroptosis during Mycobacterium tuberculosis infectionNature communicationsMay 8, 2020Beckwith KS, Beckwith MS, Ullmann S, Sætra RS, Kim H, Marstad A, Åsberg SE, Strand TA, Haug M, Niederweis M, et al.

Be the First to Write a Review!

Alix Antibody

Alix Antibody

Alix Antibody

Alix Antibody

Alix Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Sequence

Specifications/Features

Novus Biologicals, a Bio-Techne Brand

Citations (16)

Reviews

Alix Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map