CTGF/CCN2 Antibody - BSA Free NBP1-86571 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

CTGF/CCN2 Antibody

Western Blot: CTGF/CCN2 Antibody [NBP1-86571]
CTGF/CCN2 Antibody

CTGF/CCN2 Antibody
CTGF/CCN2 Antibody

Western Blot: CTGF/CCN2 Antibody [NBP1-86571] - Analysis in human cell line EFO-21.
CTGF/CCN2 Antibody

Western Blot: CTGF/CCN2 Antibody [NBP1-86571] - Analysis in human cell line EFO-21.
CTGF/CCN2 Antibody

Western Blot: CTGF/CCN2 Antibody [NBP1-86571] - Analysis in human cell line EFO-21.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
CTGF/CCN2 Antibody - BSA Free

Product Specs
ItemCTGF/CCN2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $429.00Supplier Page View Company Product Page
Catalog NumberNBP1-86571
ApplicationsWB, ICC, IF, IHC, IHC-p
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaAngiogenesis, Cancer, Cell Biology, Cytokine Research, Growth and Development, Immunology, Innate Immunity
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namecellular communication network factor 2
NCBI Gene AliasesCTGF, HCS24, IGFBP8, NOV2
ReactivityHuman (Hu)
HostRabbit
TargetCTGF/CCN2
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
Quantity0.1 ml (also 25ul)
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: LPSPDCPFPR RVKLPGKCCE EWVCDEPKDQ TVVGPALAAY RLEDTFGPDP TMIRANCLVQ TTEWSACSKT CGMG

Sequence

LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!