RICS Antibody - BSA Free NBP1-92334 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

RICS Antibody

Immunocytochemistry/Immunofluorescence: RICS Antibody [NBP1-92334] - Staining of human cell line HaCaT shows localization to nucleoplasm, nucleoli fibrillar center & the Golgi apparatus.
RICS Antibody

RICS Antibody
RICS Antibody

Immunocytochemistry/Immunofluorescence: RICS Antibody [NBP1-92334] - Staining of human cell line HaCaT shows localization to nucleoplasm, nucleoli fibrillar center & the Golgi apparatus.
RICS Antibody

Immunocytochemistry/Immunofluorescence: RICS Antibody [NBP1-92334] - Staining of human cell line HaCaT shows localization to nucleoplasm, nucleoli fibrillar center & the Golgi apparatus.
RICS Antibody

Immunocytochemistry/Immunofluorescence: RICS Antibody [NBP1-92334] - Staining of human cell line HaCaT shows localization to nucleoplasm, nucleoli fibrillar center & the Golgi apparatus.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
RICS Antibody - BSA Free

Product Specs
ItemRICS Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-92334
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
HostRabbit
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: ERDPSVLYQY QPHGKRQSSV TVVSQYDNLE DYHSLPQHQR GVFGGGGMGT YVPPGFPHPQ SRTYATALGQ GAFLPAELSL QHPETQIHAE
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
TargetRICS
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameRho GTPase activating protein 32
NCBI Gene AliasesGC-GAP, GRIT, PX-RICS, RICS, p200RhoGAP, p250GAP

Sequence

ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!