FNBP3 Antibody - BSA Free NBP1-87933 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

FNBP3 Antibody

Western Blot: FNBP3 Antibody [NBP1-87933]
FNBP3 Antibody

FNBP3 Antibody
FNBP3 Antibody

Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis using Anti-PRPF40A antibody NBP1-87933 (A) shows similar pattern to independent antibody NBP2-38400 (B).
FNBP3 Antibody

Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis using Anti-PRPF40A antibody NBP1-87933 (A) shows similar pattern to independent antibody NBP2-38400 (B).
FNBP3 Antibody

Western Blot: FNBP3 Antibody [NBP1-87933] - Analysis using Anti-PRPF40A antibody NBP1-87933 (A) shows similar pattern to independent antibody NBP2-38400 (B).

Be the first to write a review!

Citations:

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
FNBP3 Antibody - BSA Free

Product Specs
ItemFNBP3 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-87933
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Simple Western,Immunocytochemistry/ Immunofluorescence
FormatPBS (pH 7.2) and 40% Glycerol
HostRabbit
ReactivityHuman (Hu)
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namepre-mRNA processing factor 40 homolog A
NCBI Gene AliasesFNBP3, HIP-10, FBP11, FLAF1, NY-REN-6, FBP-11, Prp40, HYPA, HIP10
TargetFNBP3
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: NASTSASNTV SGTVPVVPEP EVTSIVATVV DNENTVTIST EEQAQLTSTP AIQDQSVEVS SNTGEETSKQ ETVADFTP

Sequence

NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!