Hyaluronan Synthase 3/HAS3 Antibody

Product Specs
ItemHyaluronan Synthase 3/HAS3 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $549.00Supplier Page View Company Product Page
Catalog NumberNBP1-86328
HostRabbit
ReactivityHuman,Mouse,Rat
Conjugate/TagUnconjugated
ApplicationsIF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
FormatPBS (pH 7.2) and 40% Glycerol
TargetHyaluronan Synthase 3/HAS3
Quantity0.1 ml (also 25ul)
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: RQEDAYMLDI FHEVLGGTEQ AGFFVWRSNF HEAGEGETEA SLQEGMDRVR DVVRASTFSC
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
NCBI Full Gene Namehyaluronan synthase 3
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles

Sequence

RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Ameliorative effects of Paulownia tomentosa flower absolute on atopic dermatitis‑related responses in mast cells and keratinocytes and its chemical compositionMol Med RepSeptember 10, 2026Da Yeon Yoo, Kyung Jong Won, Do Yoon Kim, Yoon Yi Kim, Ji Hye Bae, Ji Seong Yun, Hwan Myung LeeSanta Cruz Biotechnology (Dallas, TX, USA). Anti-HAS-2 (cat. no. NBP2-37446) and anti-HAS-3 (cat. no. NBP1-86328) antibodies were purchased from Novus Biologicals (Littleton, CO, USA). n-Hexane (cat. no. 4081-4110)

(2) Hyaluronan synthesis by developing cortical neurons in vitroScientific reportsJanuary 1, 0001"Fowke TM, Karunasinghe RN, Bai JZ, Jordan S, Gunn AJ, Dean JM."polyclonal anti-HAS2 (1:100; #sc-66916, Santa Cruz Biotechnology) or rabbit polyclonal anti-HAS3 (1:200; #NBP1-86328, Novus Biologicals, Littleton, CO, USA), with anti-MAP2 (1:500; #M4403, Sigma-Aldrich) overnight at

(3) CPAP-induced airway hyper-reactivity in mice is modulated by hyaluronan synthase-3Pediatric researchJanuary 1, 0001"Mayer CA, Ganguly A, Mayer A, Pabelick CM, Prakash YS, Hascall VC, Midura RJ, Cali V, Flask CA, Erokwu BO, et al."

(4) The hyaluronan metabolism in the UV-irradiated human epidermis and the relevance of in vitro epidermal modelsExperimental dermatologyJanuary 1, 0001"Šínová R, Pavlík V, Šimek M, Čepa M, Ondrej M, Nešporová K, Velebný V."

Be the First to Write a Review!