AP-2 beta/TFAP2B Antibody

Product Specs
ItemAP-2 beta/TFAP2B Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-89063
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation-exo-Seq
Conjugate/TagUnconjugated
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: QRQRQEVGSE AGSLLPQPRA ALPQLSGLDP RRDYHSVRRP DVLLHSAHHG LDAGMG
ReactivityHuman,Mouse
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
HostRabbit
TargetAP-2 beta/TFAP2B
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaNeuroscience
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nametranscription factor AP-2 beta
NCBI Gene AliasesAP-2B, AP-2beta, AP2-B, PDA2

Sequence

QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Questions and Answers

Has this antibody been used in any specific studies, particularly related to the mouse iris?

Yes, the AP-2 beta/TFAP2B antibody has been utilized in a study focused on the mouse iris, as detailed in the article by Wang et al. (2021). This research involved immunostaining to visualize major iris cell types, contributing to our understanding of iris development and its response to pupil dilation.

What species can I use this antibody on for my experiments?

The AP-2 beta/TFAP2B antibody is reactive with both mouse and human samples, making it suitable for studies involving these species.

Can this antibody be used for immunohistochemistry applications?

Yes, the AP-2 beta/TFAP2B antibody has been shown to work in immunohistochemistry applications, as evidenced by its use in the study by Wang et al. (2021), where it was employed to visualize specific cell types in the mouse iris.

What type of antibody is this, and what is its source?

The AP-2 beta/TFAP2B antibody is a polyclonal primary antibody derived from rabbit. It is designed to target the TFAP2B protein, which plays a significant role in various cellular processes.

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Single-cell characterization of anterior segment development in the mouse reveals the cell types, pathways, and signals driving formation of the trabecular meshwork and Schlemm’s canalElifeJuly 21, 2026Revathi Balasubramanian, Nicholas Tolman, Taibo Li, Abdul Hannan, Violet Bupp-Chickering, Karina Polanco, Aakriti Bhandari, Sally Zhou, Marina Simón, John Peregrin, et al.RRID:AB_2084620,"IF sections (1:100), TSA" Antibody,Rabbit polyclonal TFAP2B,Novus Biologicals,Cat# NBP1-89063; AB_11005304,IF sections (1:200) Antibody,FLT4 (Goat polyclonal),R&D Systems,Cat# AF743; RRID:AB_355563,WM

(2) Single-cell profiling of trabecular meshwork identifies mitochondrial dysfunction in a glaucoma model that is protected by vitamin B3 treatmentElifeJanuary 20, 2026Nicholas Tolman, Taibo Li, Revathi Balasubramanian, Guorong Li, Rebecca Pfeiffer, Violet Bupp-Chickering, Ruth A Kelly, Marina Simón, John Peregrin, Christa Montgomery, et al.,R&D Systems,AF2537,"IF sections (1:200), IF Whole mount (1:50)" Antibody,Rabbit polyclonal TFAP2B,Novus Biologicals,NBP1-89063,IF sections (1:200) Antibody,Rabbit polyclonal αSMA,Abcam,ab5694RRID:AB_2223021,"IF sections (1:200),

(3) Single-cell profiling of trabecular meshwork identifies mitochondrial dysfunction in a glaucoma model that is protected by vitamin B3 treatmenteLifeJanuary 20, 2026Nicholas Tolman, Taibo Li, Revathi Balasubramanian, Guorong Li, Rebecca Pfeiffer, Violet Bupp-Chickering, Ruth A Kelly, Marina Simón, John Peregrin, Christa Montgomery, et al.,R&D Systems,AF2537,"IF sections (1:200), IF Whole mount (1:50)" Antibody,Rabbit polyclonal TFAP2B,Novus Biologicals,NBP1-89063,IF sections (1:200) Antibody,Rabbit polyclonal αSMA,Abcam,ab5694RRID:AB_2223021,"IF sections (1:200),

(4) A transcriptome atlas of the mouse iris at single-cell resolution defines cell types and the genomic response to pupil dilationeLifeNovember 16, 2021Wang J, Rattner A, Nathans J.(Sigma F3777); mouse mAb anti-SMA, Cy3-conjugated (Sigma C6198); rabbit anti-TFAP2B (Novus Biologicals NBP1-89063); goat anti-SOX10 (Santa Cruz Biotechnology SC-17342); rabbit anti-SOX10 (Cell Signaling Technologies

(5) Generation of a new mouse model of glaucoma characterized by reduced expression of the AP-2β and AP-2δ proteinsScientific reportsJanuary 1, 0001"Barzago MM, Kurosaki M, Fratelli M, Bolis M, Giudice C, Nordio L, Cerri E, Domenici L, Terao M, Garattini E."according to standard procedures26 using antibodies recognizing the following mouse proteins: anti-AP2β (NBP1-89063, Novus Biologicals Europe, Abingdon, UK); anti-AP2δ (NBP2-13428, Novus Biologicals Europe); anti-XDH40;

Be the First to Write a Review!