RAP80 Antibody

Product Specs
ItemRAP80 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $579.00Supplier Page View Company Product Page
Catalog NumberNBP1-87156
Quantity0.1 ml (also 25ul)
FormatPBS (pH 7.2) and 40% Glycerol
HostRabbit
Conjugate/TagUnconjugated
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: LLRKAIAESL NSCRPSDASA TRSRPLATGP SSQSHQEKTT DSGLTEGIWQ LVPPSLFKGS HISQGNEAEE REEPWDHTEK TEEEPVSGSS G
NCBI Full Gene Nameubiquitin interaction motif containing 1
ApplicationsWB, ICC, IF, IHC, IHC-p, IM
ReactivityHu, Ms
IsotypeIgG
ClonalityPolyclonal
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Research AreaBreast Cancer, Cancer
PurityAffinity purified
TargetRAP80
NCBI Gene AliasesRAP80, X2HRIP110

Sequence

LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) Autologous K63 deubiquitylation within the BRCA1-A complex licenses DNA damage recognitionThe Journal of cell biologySeptember 5, 2022Jiang Q, Foglizzo M, Morozov YI, Yang X, Datta A, Tian L, Thada V, Li W, Zeqiraj E, Greenberg RA.antibodies were used for western blotting for human or mouse cells: Rabbit anti-human/mouse RAP80 (NBP1-87156; Novus Biologicals) at 1:1,000 for human cells, 1:100 for mouse cells; Rabbit anti-human RAP80 (A300-763A;

(2) Two redundant ubiquitin-dependent pathways of BRCA1 localization to DNA damage sitesEMBO reportsDecember 6, 2021Sherker A, Chaudhary N, Adam S, Heijink AM, Noordermeer SM, Fradet-Turcotte A, Durocher D.1:150,000), rabbit anti‐RAP80 rabbit (A300‐763A, Bethyl Laboratories Inc., 1:200), anti‐RAP80 rabbit (NBP1‐87156, Novus Biologicals, 1:500), rabbit anti‐ABRAXAS (A302‐180A, Bethyl Laboratories Inc., 1:500), rabbit

(3) Proteome dynamics at broken replication forks reveal a distinct ATM-directed repair response suppressing DNA double-strand break ubiquitinationMolecular cellMarch 4, 2021Nakamura K, Kustatscher G, Alabert C, Hödl M, Forne I, Völker-Albert M, Satpathy S, Beyer TE, Mailand N, Choudhary C, et al.AB_10015219 ssDNA,Millipore,MAB3034; RRID: AB_94645 NDRG3,Santa Cruz Biotechnology,sc-514561 RAP80,Novus,NBP1-87156; RRID: AB_10999813 RNF168,R&D BIosystems,AF7217; RRID: AB_10971653 ,, "Chemicals, peptides, and recombinant

(4) Single-dose radiotherapy disables tumor cell homologous recombination via ischemia/reperfusion injuryThe Journal of clinical investigationFebruary 1, 2019Bodo S, Campagne C, Thin TH, Higginson DS, Vargas HA, Hua G, Fuller JD, Ackerstaff E, Russell J, Zhang Z, et al.(Millipore, 05-1572 [clone P2B11]; dilution 1:100), rabbit polyclonal anti-RAP80 (Novus Biologicals, NBP1-87156; dilution 1:50), rabbit polyclonal anti-RNF4 (gift from Jorma Palvimo, Institute of Biomedicine, University

(5) Human Rad52 Promotes XPG-Mediated R-loop Processing to Initiate Transcription-Associated Homologous Recombination RepairCellOctober 4, 2018Yasuhara T, Kato R, Hagiwara Y, Shiotani B, Yamauchi M, Nakada S, Shibata A, Miyagawa K.

(6) MDC1 methylation mediated by lysine methyltransferases EHMT1 and EHMT2 regulates active ATM accumulation flanking DNA damage sitesScientific reportsJuly 18, 2018Watanabe S, Iimori M, Chan DV, Hara E, Kitao H, Maehara Y.Conjugated ubiquitin (FK2; Enzo Life Sciences, BML-PW8800; IF, 1:10,000); RAP80 (Novus Biologicals, NBP1-87156; IF, 1:300); γ-H2AX (Millipore, 05–636, IF, 1:1000; WB, 1:500); Flag (WAKO, 018–22381; WB, 1:5000, Medical

(7) The Ubiquitin E3/E4 Ligase UBE4A Adjusts Protein Ubiquitylation and Accumulation at Sites of DNA Damage, Facilitating Double-Strand Break RepairMolecular cellMarch 1, 2018Baranes-Bachar K, Levy-Barda A, Oehler J, Reid DA, Soria-Bretones I, Voss TC, Chung D, Park Y, Liu C, Yoon JB, et al.

(8) The anaphase promoting complex impacts repair choice by protecting ubiquitin signalling at DNA damage sitesNature communicationsJune 12, 2017Ha K, Ma C, Lin H, Tang L, Lian Z, Zhao F, Li JM, Zhen B, Pei H, Han S, et al.(IF), 1:1,000 (WB)) (Proteintech); anti-FK2 (BML-PW8810-0100, 1:250) (Enzo Life Sciences); anti-RAP80 (NBP1-87156, 1:250), anti-RAD51 (NB100-148, 1:250), anti-53BP1 (NB100-304, 1:250), anti-DNA-PKcs (phosphoT2609,

(9) Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cellsNucleic acids researchJanuary 29, 2016Renaud E, Barascu A, Rosselli F.Millipore), Mre11 (GTX70212, GeneTex), Rad51 (PC130, Calbiochem), RIF1 (A300–569A, Bethyl), RAP80 (NBP1–87156, Novus) and acetylated lysine (MA1–2021, Thermo). Primary antibody detection was achieved by incubation

(10) Triapine disrupts CtIP-mediated homologous recombination repair and sensitizes ovarian cancer cells to PARP and topoisomerase inhibitorsMolecular cancer research : MCRMarch 1, 2014Lin ZP, Ratner ES, Whicker ME, Lee Y, Sartorelli AC.

(11) Fine-tuning of DNA damage-dependent ubiquitination by OTUB2 supports the DNA repair pathway choiceMolecular cellFebruary 20, 2014Kato K, Nakajima K, Ui A, Muto-Terao Y, Ogiwara H, Nakada S.

Be the First to Write a Review!

RAP80 Antibody

RAP80 Antibody

RAP80 Antibody

RAP80 Antibody

RAP80 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

Sequence

Specifications/Features

Novus Biologicals, a Bio-Techne Brand

Citations (11)

Reviews

RAP80 Antibody - BSA Free from Novus Biologicals, a Bio-Techne Brand

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map