Pab Rb x human TAP2 (Antigen Peptide Transporter 2, ABC Transporter, MHC 2, ABCB3, APT2, Peptide Transporter PSF2, Peptide Transporter TAP2, Psf2 PSF-2, RING11, SEC14L3, TAP 2) antibody 353303 from United States Biological

Product Specs
ItemPab Rb x human TAP2 (Antigen Peptide Transporter 2, ABC Transporter, MHC 2, ABCB3, APT2, Peptide Transporter PSF2, Peptide Transporter TAP2, Psf2 PSF-2, RING11, SEC14L3, TAP 2) antibody
CompanyUnited States Biological
Price $479.00Supplier Page View Company Product Page
Catalog Number353303
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml
ApplicationsWB
ImmunogenSynthetic peptide corresponding to aa611-651, QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR, of human TAP2 at C-terminal, different from the related mouse sequence by 5aa, and from the related rat sequence by 6aa
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nametransporter 2, ATP binding cassette subfamily B member
NCBI Gene AliasesABC18, ABCB3, APT2, D6S217E, PSF-2, PSF2, RING11
ClonalityPolyclonal
TargetTAP2