Blocking Peptides

Blocking Peptides Blocking peptide reagents are typically produced through synthetic methods, where specific sequences of amino acids are assembled to create peptides useful in protein studies. In immunostaining applications like immunohistochemistry, blocking peptides can be used to block specific antibody-antigen interactions to help reduce non-specific binding and improve the specificity of antibody staining. In Western blots, they can be used to confirm the specificity of antibody binding. They can also be used in functional assays to inhibit protein activity when studying protein functions, interactions, or related biochemical pathways. Synthetic blocking peptides are usually synthesized using solid-phase peptide synthesis, purified by HPLC, and subsequently characterized to confirm identity and purity. Visit the peptide supplier page for more information, including peptide sequence, species reactivity, and validated applications.

Blocking Peptides

Your search returned 26 Blocking Peptides across 1 supplier.
Showing 26 of 26 products
  • <<
  • >>
Select up to 5 products from below to compare or request more information.
COX-2 (human) Blocking Peptide
  • Description:
    Peptide Sequence: Human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)
    • To be used in conjunction ...
  • Quantity:
    200 µg
  • Applications:
    Inquire
COX-2 (mouse) Blocking Peptide
  • Description:
    Peptide Sequence: mouse COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK) · To be used in conjunction with ...
  • Quantity:
    200 µg
  • Applications:
    Inquire
Fatty Acid Amide Hydrolase Blocking Peptide
  • Description:
    Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS){9140} · To be used in conjunction ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
LDL Receptor Blocking Peptide
  • Description:
    To be used in conjunction with Cayman’s NPC1L1 Polyclonal Antibody (Item No. 100076655) to block protein-antibody ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
11&#946;-Hydroxysteroid Dehydrogenase (Type 1) Blocking Peptide
  • Description:
    Peptide Sequence: Human 11β-HSD1 amino acids 78-92 (CLELGAASAHYLAGT)
    • To be used in conjunction with Cayman&...
  • Quantity:
    1 ea
  • Applications:
    Inquire
15-Lipoxygenase-2 Blocking Peptide
  • Description:
    Immunogen: Synthetic peptide from the internal region of 15-LO-2 · To be used in conjunction with Cayman’s 15...
  • Quantity:
    1 ea
  • Applications:
    Inquire
Autotaxin Blocking Peptide

Autotaxin Blocking Peptide

Cayman Chemical

  • Description:
    Peptide Sequence: rat lyso-PLD amino acids 573-588
    • To be used in conjunction with Cayman’s lyso-PLD ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
CB1 Receptor (C-Term) Blocking Peptide
  • Description:
    Peptide Sequence: CB1 receptor (C-Term) amino acids 461-472 · To be used in conjunction with Cayman’s CB1 ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
CB1 Receptor Blocking Peptide
  • Description:
    To be used in conjunction with Cayman’s CB1 receptor polyclonal antibody (Item No. 101500) to block protein-...
  • Quantity:
    200 µg
  • Applications:
    Inquire
CB2 Receptor Blocking Peptide
  • Description:
    Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK) · To be used in conjunction with ...
  • Quantity:
    200 µg
  • Applications:
    Inquire
CRTH2/DP2 Receptor (N-Term) Blocking Peptide
  • Description:
    To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (N-Term) polyclonal antibody (Item No. 10004886) to ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
Chemokine-Like Receptor 1 Blocking Peptide
  • Description:
    To be used in conjunction with Cayman’s Chemokine-Like Receptor 1 Polyclonal Antibody to block protein-antibody ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
EP2 Receptor Blocking Peptide
  • Description:
    Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL){3178} · To be used in ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
EP3 Receptor Blocking Peptide
  • Description:
    Peptide Sequence: Human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF){3180,1900}
    • To be used ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
EP4 Receptor (C-Term) Blocking Peptide
  • Description:
    Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
GPR55 Blocking Peptide

GPR55 Blocking Peptide

Cayman Chemical

  • Description:
    To be used in conjunction with Cayman’s GPR55 Polyclonal Antibody to block protein-antibody complex formation ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
LPA1 Blocking Peptide

LPA1 Blocking Peptide

Cayman Chemical

  • Description:
    Peptide Sequence: human LPA1 amino acids 342-359 · To be used in conjunction with Cayman’s LPA1 polyclonal ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
Monoacylglycerol Lipase Blocking Peptide
  • Description:
    Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
NAPE-PLD Blocking Peptide (aa 159-172)
  • Description:
    To block protein-antibody complex formation during immunochemical analysis of NAPE-PLD
  • Quantity:
    1 ea
  • Applications:
    Inquire
PAF Acetylhydrolase Blocking Peptide
  • Description:
    Peptide Sequence: Human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN){2618}
    • To be used in conjunction ...
  • Quantity:
    200 µg
  • Applications:
    Inquire
Prostaglandin D Synthase (hematopoietic-type) Blocking Peptide
  • Description:
    Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE){8451} · To be used in ...
  • Quantity:
    200 µg
  • Applications:
    Inquire
Prostaglandin E Synthase (cytosolic) Blocking Peptide
  • Description:
    Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK){8691} · To be used in conjunction with Cayman&...
  • Quantity:
    1 ea
  • Applications:
    Inquire
Prostaglandin E Synthase-1 (microsomal) Blocking Peptide
  • Description:
    Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND){7229} · To be used in conjunction with Cayman’s...
  • Quantity:
    1 ea
  • Applications:
    Inquire
Prostaglandin E Synthase-2 (microsomal) Blocking Peptide
  • Description:
    Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
Scavenger Receptor B2/CD36 Blocking Peptide
  • Description:
    Peptide Sequence: Human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF)
    • To be used in conjunction with ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
Sphingosine Kinase 1 Blocking Peptide
  • Description:
    Peptide Sequence: human SPHK1 amino acids 264-274 (DLESEKYRRLG) · To be used in conjunction with Cayman’s ...
  • Quantity:
    1 ea
  • Applications:
    Inquire
Select up to 5 products from above to compare or request more information.

Tags:

Please Login or Register to Create Tags