
Blocking peptide reagents are typically produced through synthetic methods, where specific sequences of amino acids are assembled to create peptides useful in protein studies. In immunostaining applications like immunohistochemistry, blocking peptides can be used to block specific antibody-antigen interactions to help reduce non-specific binding and improve the specificity of antibody staining. In Western blots, they can be used to confirm the specificity of antibody binding. They can also be used in functional assays to inhibit protein activity when studying protein functions, interactions, or related biochemical pathways. Synthetic blocking peptides are usually synthesized using solid-phase peptide synthesis, purified by HPLC, and subsequently characterized to confirm identity and purity. Visit the peptide supplier page for more information, including peptide sequence, species reactivity, and validated applications.
Your search returned 26 Blocking Peptides across 1 supplier.
Select up to 5 products from below to compare or request more information.
- Peptide Sequence: Human COX-2 amino acids 567-599 (SVPDPELIKTVTINASSSRSGLDDINPTVLLKE)
• To be used in conjunction ... - 200 µg
- Inquire
- Peptide Sequence: mouse COX-2 amino acids 570-598 (DPQPTKTATINASASHSRLDDINPTVLIK) · To be used in conjunction with ...
- 200 µg
- Inquire
- Peptide Sequence: rat FAAH amino acids sequence 561-579 (CLRFMREVEQLMTPQKQPS){9140} · To be used in conjunction ...
- 1 ea
- Inquire
- To be used in conjunction with Cayman’s NPC1L1 Polyclonal Antibody (Item No. 100076655) to block protein-antibody ...
- 1 ea
- Inquire
- Peptide Sequence: Human 11β-HSD1 amino acids 78-92 (CLELGAASAHYLAGT)
• To be used in conjunction with Cayman&... - 1 ea
- Inquire
- Immunogen: Synthetic peptide from the internal region of 15-LO-2 · To be used in conjunction with Cayman’s 15...
- 1 ea
- Inquire
- Peptide Sequence: rat lyso-PLD amino acids 573-588
• To be used in conjunction with Cayman’s lyso-PLD ... - 1 ea
- Inquire
- Peptide Sequence: CB1 receptor (C-Term) amino acids 461-472 · To be used in conjunction with Cayman’s CB1 ...
- 1 ea
- Inquire
- To be used in conjunction with Cayman’s CB1 receptor polyclonal antibody (Item No. 101500) to block protein-...
- 200 µg
- Inquire
- Peptide Sequence: human CB2 receptor sequence amino acids 20-33 (NPMKDYMILSGPQK) · To be used in conjunction with ...
- 200 µg
- Inquire
- To be used in conjunction with Cayman’s CRTH2/DP2 Receptor (N-Term) polyclonal antibody (Item No. 10004886) to ...
- 1 ea
- Inquire
- To be used in conjunction with Cayman’s Chemokine-Like Receptor 1 Polyclonal Antibody to block protein-antibody ...
- 1 ea
- Inquire
- Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL){3178} · To be used in ...
- 1 ea
- Inquire
- Peptide Sequence: Human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF){3180,1900}
• To be used ... - 1 ea
- Inquire
- Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in ...
- 1 ea
- Inquire
- To be used in conjunction with Cayman’s GPR55 Polyclonal Antibody to block protein-antibody complex formation ...
- 1 ea
- Inquire
- Peptide Sequence: human LPA1 amino acids 342-359 · To be used in conjunction with Cayman’s LPA1 polyclonal ...
- 1 ea
- Inquire
- Peptide Sequence: human monoacylglycerol lipase blocking peptide amino acids 1-14 (MPEESSPRRTPQSI) · To be used in ...
- 1 ea
- Inquire
- To block protein-antibody complex formation during immunochemical analysis of NAPE-PLD
- 1 ea
- Inquire
- Peptide Sequence: Human C-terminal amino acids 420-441 (TNINTTNQHIMLQNSSGIEKYN){2618}
• To be used in conjunction ... - 200 µg
- Inquire
- Peptide Sequence: Human hematopoietic type PGD synthase amino acids 30-41 (EDHRIEQADWPE){8451} · To be used in ...
- 200 µg
- Inquire
- Peptide sequence: human cPGE synthase amino acids 58-67 (CIDPNDSKHK){8691} · To be used in conjunction with Cayman&...
- 1 ea
- Inquire
- Peptide Sequence: human amino acids 59-75 (CRSDPDVERSLRAHRND){7229} · To be used in conjunction with Cayman’s...
- 1 ea
- Inquire
- Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) · To be used in conjunction with Cayman’s mPGE ...
- 1 ea
- Inquire
- Peptide Sequence: Human CD36 sequence amino acids 98-114 (AKENVTQDAEDNTVSF)
• To be used in conjunction with ... - 1 ea
- Inquire
- Peptide Sequence: human SPHK1 amino acids 264-274 (DLESEKYRRLG) · To be used in conjunction with Cayman’s ...
- 1 ea
- Inquire
Select up to 5 products from above to compare or request more information.
Tags:
Please Login or Register to Create Tags