Bio-Rad (Formerly AbD Serotec)'s HuCAL Fab-FSx2 NEGATIVE CONTROL antibody is a Human monoclonal antibody. This antibody has been shown to work in applications such as: EIA, Immunoassay, and ELISA.
Description
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL GOLD phage display library. Expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid