SP140 Antibody - BSA Free NBP2-49517 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

SP140 Antibody

Immunocytochemistry/Immunofluorescence: SP140 Antibody [NBP2-49517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & mitochondria.
SP140 Antibody

SP140 Antibody
SP140 Antibody

Immunocytochemistry/Immunofluorescence: SP140 Antibody [NBP2-49517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & mitochondria.
SP140 Antibody

Immunocytochemistry/Immunofluorescence: SP140 Antibody [NBP2-49517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & mitochondria.
SP140 Antibody

Immunocytochemistry/Immunofluorescence: SP140 Antibody [NBP2-49517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & mitochondria.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
SP140 Antibody - BSA Free

Product Specs
ItemSP140 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-49517
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetSP140
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: LSLLPGEGEE GSDDCSEMCD GEERQEASSS LARRGSVSSE LENHPMNEEG ESEELASSLL YDNVPGAEQS A
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameSP140 nuclear body protein
NCBI Gene AliasesLYSP100, LYSP100-A, LYSP100-B

Sequence

LSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELENHPMNEEGESEELASSLLYDNVPGAEQSA

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!