RP11-195F19.5 Antibody - BSA Free NBP2-49609 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

RP11-195F19.5 Antibody

Immunocytochemistry/Immunofluorescence: RP11-195F19.5 Antibody [NBP2-49609] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoli, endoplasmic reticulum & vesicles.
RP11-195F19.5 Antibody

RP11-195F19.5 Antibody
RP11-195F19.5 Antibody

Immunocytochemistry/Immunofluorescence: RP11-195F19.5 Antibody [NBP2-49609] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoli, endoplasmic reticulum & vesicles.
RP11-195F19.5 Antibody

Immunocytochemistry/Immunofluorescence: RP11-195F19.5 Antibody [NBP2-49609] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoli, endoplasmic reticulum & vesicles.
RP11-195F19.5 Antibody

Immunocytochemistry/Immunofluorescence: RP11-195F19.5 Antibody [NBP2-49609] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleoli, endoplasmic reticulum & vesicles.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
RP11-195F19.5 Antibody - BSA Free

Product Specs
ItemRP11-195F19.5 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $559.00Supplier Page View Company Product Page
Catalog NumberNBP2-49609
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsICC, IF, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: PLQETFGAQD MSGMRRYEVA LEAEEEIYWG CFYFFPWLRM WRRERSSAHP GEQKLEPLRG LMSCLSSGLG PTPQRSGRGF PRRSPTAAAQ PASALK
HostRabbit
IsotypeIgG
TargetRP11-195F19.5
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Specifications/Features

Available conjugates: Unconjugated

Sequence

PLQETFGAQDMSGMRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPGEQKLEPLRGLMSCLSSGLGPTPQRSGRGFPRRSPTAAAQPASALK

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!