DNAJC3 Antibody - BSA Free NBP2-48704 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

DNAJC3 Antibody

Western Blot: DNAJC3 Antibody [NBP2-48704]
DNAJC3 Antibody

DNAJC3 Antibody
DNAJC3 Antibody

Western Blot: DNAJC3 Antibody [NBP2-48704] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4
DNAJC3 Antibody

Western Blot: DNAJC3 Antibody [NBP2-48704] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4
DNAJC3 Antibody

Western Blot: DNAJC3 Antibody [NBP2-48704] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
DNAJC3 Antibody - BSA Free

Product Specs
ItemDNAJC3 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $549.00Supplier Page View Company Product Page
Catalog NumberNBP2-48704
NCBI Gene AliasesACPHD, ERdj6, HP58, P58, P58IPK, PRKRI, p58(IPK)
NCBI Full Gene NameDnaJ heat shock protein family (Hsp40) member C3
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Antibody TypePrimary Antibodies
Research AreaCellular Markers, Golgi Apparatus Markers, Lipid and Metabolism, Unfolded Protein Response
PurityAffinity purified
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsWB, ICC, IF, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: YKISTLYYQL GDHELSLSEV RECLKLDQDH KRCFAHYKQV KKLNKLIESA EELIRDGRYT DATSKYESVM KTEPSIAEYT VR
HostRabbit
IsotypeIgG
TargetDNAJC3
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Specifications/Features

Available conjugates: Unconjugated

Sequence

YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVR

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!