58K Golgi Protein Antibody - BSA Free NBP2-48600 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

58K Golgi Protein Antibody

Western Blot: 58K Golgi Protein Antibody [NBP2-48600]
58K Golgi Protein Antibody

58K Golgi Protein Antibody
58K Golgi Protein Antibody

Western Blot: 58K Golgi Protein Antibody [NBP2-48600] - Analysis using Anti-FTCD antibody NBP2-48600 (A) shows similar pattern to independent antibody NBP2-48601 (B).
58K Golgi Protein Antibody

Western Blot: 58K Golgi Protein Antibody [NBP2-48600] - Analysis using Anti-FTCD antibody NBP2-48600 (A) shows similar pattern to independent antibody NBP2-48601 (B).
58K Golgi Protein Antibody

Western Blot: 58K Golgi Protein Antibody [NBP2-48600] - Analysis using Anti-FTCD antibody NBP2-48600 (A) shows similar pattern to independent antibody NBP2-48601 (B).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
58K Golgi Protein Antibody - BSA Free

Product Specs
Item58K Golgi Protein Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP2-48600
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
Target58K Golgi Protein
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: TKEQAHRIAL NLREQGRGKD QPGRLKKVQG IGWYLDEKNL AQVSTNLLDF EVTALHTVYE ETCREAQELS LPVVGSQLVG LVPLKALLD
ClonalityPolyclonal
PurityAffinity purified
Research AreaCellular Markers, Golgi Apparatus Markers, Lipid and Metabolism, Signal Transduction
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameformimidoyltransferase cyclodeaminase
NCBI Gene AliasesLCHC1

Sequence

TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLD

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!