Hsp70 interacting protein HIP Antibody - BSA Free NBP2-48866 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Hsp70 interacting protein HIP Antibody

Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-48866] - Analysis in human cell line RT-4.
Hsp70 interacting protein HIP Antibody

Hsp70 interacting protein HIP Antibody
Hsp70 interacting protein HIP Antibody

Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-48866] - Analysis in human cell line RT-4.
Hsp70 interacting protein HIP Antibody

Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-48866] - Analysis in human cell line RT-4.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Hsp70 interacting protein HIP Antibody - BSA Free

Product Specs
ItemHsp70 interacting protein HIP Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-48866
Quantity0.1 ml
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetHsp70 interacting protein HIP
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: AIEINPDSAQ PYKWRGKAHR LLGHWEEAAH DLALACKLDY DEDASAMLKE VQPRAQKIAE HRRKYER
ClonalityPolyclonal
PurityAffinity purified
Research AreaMembrane Trafficking and Chaperones
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameST13 Hsp70 interacting protein
NCBI Gene AliasesAAG2, FAM10A1, FAM10A4, HIP, HOP, HSPABP, HSPABP1, P48, PRO0786, SNC6

Sequence

AIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!