C6orf47 Antibody - BSA Free NBP2-48828 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

C6orf47 Antibody

Western Blot: C6orf47 Antibody [NBP2-48828]
C6orf47 Antibody

C6orf47 Antibody
C6orf47 Antibody

Western Blot: C6orf47 Antibody [NBP2-48828] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4
C6orf47 Antibody

Western Blot: C6orf47 Antibody [NBP2-48828] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4
C6orf47 Antibody

Western Blot: C6orf47 Antibody [NBP2-48828] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
C6orf47 Antibody - BSA Free

Product Specs
ItemC6orf47 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-48828
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetC6orf47
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: EPSKEEPQVE QLGSKRMDSL KWDQPISSTQ ESGRLEAGGA SPKLRWDHVD SGGTRRPGVS PEGGLSVPGP GAPLEK
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namechromosome 6 open reading frame 47
NCBI Gene AliasesD6S53E, G4, NG34

Sequence

EPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHVDSGGTRRPGVSPEGGLSVPGPGAPLEK

Specifications/Features

Available conjugates: Unconjugated

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!