Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free NBP2-49293 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Clathrin Heavy Chain 1/CHC17 Antibody

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Clathrin Heavy Chain 1/CHC17 Antibody

Clathrin Heavy Chain 1/CHC17 Antibody
Clathrin Heavy Chain 1/CHC17 Antibody

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Clathrin Heavy Chain 1/CHC17 Antibody

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue
Clathrin Heavy Chain 1/CHC17 Antibody

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free

Product Specs
ItemClathrin Heavy Chain 1/CHC17 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $559.00Supplier Page View Company Product Page
Catalog NumberNBP2-49293
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameclathrin heavy chain
NCBI Gene AliasesCHC, CHC17, CLH-17, CLTCL2, Hc, MRD56
Research AreaMembrane Trafficking and Chaperones, Membrane Vesicle Markers
PurityAffinity purified
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsWB, ICC, IF, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: ESLRKEEEQA TETQPIVYGQ PQLMLTAGPS VAVPPQ
HostRabbit
IsotypeIgG
TargetClathrin Heavy Chain 1/CHC17
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Specifications/Features

Available conjugates: Unconjugated

Sequence

ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!