Apolipoprotein E/ApoE Antibody

Product Specs
ItemApolipoprotein E/ApoE Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $549.00Supplier Page View Company Product Page
Catalog NumberNBP2-49450
Quantity0.1 ml
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
TargetApolipoprotein E/ApoE
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: ARMEEMGSRT RDRLDEVKEQ VAEVRAKLEE QAQQIRLQAE AFQARLKSWF EPLVEDMQRQ W
ClonalityPolyclonal
PurityAffinity purified
Research AreaAlzheimers Research, Apoptosis, Cancer, Cholesterol Metabolism, Cognition and Behavior, Lipid and Metabolism, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Signal Transduction
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Nameapolipoprotein E
NCBI Gene AliasesAD2, APO-E, ApoE4, LDLCQ5, LPG

Sequence

ARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQW

Specifications/Features

Available conjugates: Unconjugated

Questions and Answers

What applications can I use the Apolipoprotein E antibody for in my research?

The Apolipoprotein E antibody has been shown to work in various applications including Western Blotting, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, and Immunohistochemistry on paraffin-embedded sections.

Is this antibody specific to human samples, or can it be used in other species?

This antibody is specifically reactive to Homo sapiens, meaning it is designed for use with human samples.

Can you tell me about the immunogen used for this antibody?

The Apolipoprotein E antibody was developed against a recombinant protein corresponding to specific amino acids of the ApoE protein, which enhances its specificity and affinity for the target.

What are some research areas where this antibody might be particularly useful?

This antibody is relevant in several research areas, including Alzheimer's research, apoptosis, cancer, cholesterol metabolism, cognition and behavior, lipid and metabolism studies, neurodegeneration, neuronal cell markers, neuroscience, and signal transduction.