S100P binding protein Antibody - BSA Free NBP2-48581 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

S100P binding protein Antibody

Western Blot: S100P binding protein Antibody [NBP2-48581] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp
S100P binding protein Antibody

S100P binding protein Antibody
S100P binding protein Antibody

Western Blot: S100P binding protein Antibody [NBP2-48581] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp
S100P binding protein Antibody

Western Blot: S100P binding protein Antibody [NBP2-48581] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
S100P binding protein Antibody - BSA Free

Product Specs
ItemS100P binding protein Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP2-48581
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman
PurityAffinity purified
TargetS100P binding protein
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: PDLFKLPQLS TSSGHGPAHT KPLNRRSVLE KNLIKVTVAP FNPTVCDALL DKDETDSSKD TEKLSSLGEE MREDGLSPNE SKLCTESEGI SPNNS
Antibody TypePrimary Antibodies
ClonalityPolyclonal
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameS100P binding protein
NCBI Gene AliasesS100PBPR

Specifications/Features

Available conjugates: Unconjugated

Sequence

PDLFKLPQLSTSSGHGPAHTKPLNRRSVLEKNLIKVTVAPFNPTVCDALLDKDETDSSKDTEKLSSLGEEMREDGLSPNESKLCTESEGISPNNS

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!