FAM213A Antibody - BSA Free NBP2-48517 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

FAM213A Antibody

Western Blot: FAM213A Antibody [NBP2-48517]
FAM213A Antibody

Western Blot: FAM213A Antibody [NBP2-48517] - Analysis in human cell lines SK-MEL-30 and PC-3 using anti-FAM213A antibody. Corresponding FAM213A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
FAM213A Antibody

FAM213A Antibody
FAM213A Antibody

Western Blot: FAM213A Antibody [NBP2-48517] - Analysis in human cell lines SK-MEL-30 and PC-3 using anti-FAM213A antibody. Corresponding FAM213A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
FAM213A Antibody

Western Blot: FAM213A Antibody [NBP2-48517] - Analysis in human cell lines SK-MEL-30 and PC-3 using anti-FAM213A antibody. Corresponding FAM213A RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
FAM213A Antibody - BSA Free

Product Specs
ItemFAM213A Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP2-48517
Quantity0.1 ml (also 25ul)
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
ReactivityHuman,Rat
TargetFAM213A
IsotypeIgG
HostRabbit
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: NTDVFLSKPQ KAALEYLEDI DLKTLEKEPR TFKAKELWEK NGAVIMAVRR PGCFLCREEA ADLSSLKSML DQLGVPLYAV VKEHIRTEVK DFQPYFKGE
ClonalityPolyclonal
PurityAffinity purified
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesAdrx, C10orf58, FAM213A, PAMM
NCBI Full Gene Nameperoxiredoxin like 2A
Antibody TypePrimary Antibodies

Sequence

NTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGE

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!