FAM124B Antibody - BSA Free NBP2-49625 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

FAM124B Antibody

Immunocytochemistry/Immunofluorescence: FAM124B Antibody [NBP2-49625] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
FAM124B Antibody

FAM124B Antibody
FAM124B Antibody

Immunocytochemistry/Immunofluorescence: FAM124B Antibody [NBP2-49625] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
FAM124B Antibody

Immunocytochemistry/Immunofluorescence: FAM124B Antibody [NBP2-49625] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.
FAM124B Antibody

Immunocytochemistry/Immunofluorescence: FAM124B Antibody [NBP2-49625] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
FAM124B Antibody - BSA Free

Product Specs
ItemFAM124B Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-49625
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene Namefamily with sequence similarity 124 member B
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsICC, IF, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: MDETQGPLAM TVHLLANSGH GSLLQRTLDQ LLDCICPEVR LFQVSERASP VKYCEKSHSK RSRFPGMSVL LFLHESPGED RLFRVLDSLQ HSPWQCYPTQ
HostRabbit
IsotypeIgG
TargetFAM124B
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Specifications/Features

Available conjugates: Unconjugated

Sequence

MDETQGPLAMTVHLLANSGHGSLLQRTLDQLLDCICPEVRLFQVSERASPVKYCEKSHSKRSRFPGMSVLLFLHESPGEDRLFRVLDSLQHSPWQCYPTQ

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!