Hsp70 interacting protein HIP Antibody - BSA Free NBP2-48786 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

Hsp70 interacting protein HIP Antibody

Immunocytochemistry/Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48786] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Hsp70 interacting protein HIP Antibody

Hsp70 interacting protein HIP Antibody
Hsp70 interacting protein HIP Antibody

Immunocytochemistry/Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48786] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Hsp70 interacting protein HIP Antibody

Immunocytochemistry/Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48786] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Hsp70 interacting protein HIP Antibody

Immunocytochemistry/Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-48786] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
Hsp70 interacting protein HIP Antibody - BSA Free

Product Specs
ItemHsp70 interacting protein HIP Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP2-48786
Antibody TypePrimary Antibodies
NCBI Gene AliasesAAG2, FAM10A1, FAM10A4, HIP, HOP, HSPABP, HSPABP1, P48, PRO0786, SNC6
NCBI Full Gene NameST13 Hsp70 interacting protein
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Research AreaMembrane Trafficking and Chaperones
PurityAffinity purified
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsICC, IF, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: KVNELRAFVK MCKQDPSVLH TEEMRFLREW VESMGGKVPP ATQKAKSEEN TKEEKPDSKK VEEDLKADEP
HostRabbit
IsotypeIgG
TargetHsp70 interacting protein HIP
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Specifications/Features

Available conjugates: Unconjugated

Sequence

KVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKPDSKKVEEDLKADEP

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!