58K Golgi Protein Antibody - BSA Free NBP2-48651 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

58K Golgi Protein Antibody

Western Blot: 58K Golgi Protein Antibody [NBP2-48651] - Analysis using Anti-FTCD antibody NBP2-48651 (A) shows similar pattern to independent antibody NBP2-48600 (B).
58K Golgi Protein Antibody

58K Golgi Protein Antibody
58K Golgi Protein Antibody

Western Blot: 58K Golgi Protein Antibody [NBP2-48651] - Analysis using Anti-FTCD antibody NBP2-48651 (A) shows similar pattern to independent antibody NBP2-48600 (B).
58K Golgi Protein Antibody

Western Blot: 58K Golgi Protein Antibody [NBP2-48651] - Analysis using Anti-FTCD antibody NBP2-48651 (A) shows similar pattern to independent antibody NBP2-48600 (B).
58K Golgi Protein Antibody

Western Blot: 58K Golgi Protein Antibody [NBP2-48651] - Analysis using Anti-FTCD antibody NBP2-48651 (A) shows similar pattern to independent antibody NBP2-48600 (B).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
58K Golgi Protein Antibody - BSA Free

Product Specs
Item58K Golgi Protein Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP2-48651
PurityAffinity purified
Research AreaCellular Markers, Golgi Apparatus Markers, Lipid and Metabolism, Signal Transduction
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesLCHC1
NCBI Full Gene Nameformimidoyltransferase cyclodeaminase
Antibody TypePrimary Antibodies
ReactivityHuman (Hu)
ClonalityPolyclonal
ApplicationsWB, ICC, IF, IHC, IHC-p
ImmunogenThis antibody was developed against a recombinant protein corresponding to amino acids: GVSVDECVLC AQAFGQRLAE ELDVPVYLYG EAARMDSRRT LPAIRAGEYE ALPKKLQQAD WAPDFGPSSF
HostRabbit
IsotypeIgG
Target58K Golgi Protein
FormatPBS (pH 7.2) and 40% Glycerol
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)

Specifications/Features

Available conjugates: Unconjugated

Sequence

GVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSF

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!